C-peptide is a bioactive peptide

Bioactive Peptide Discovery Platform

Food-protein derived bioactive peptides are short amino acid chains that are inactive within the sequence of the parent protein, but can be released through hydrolysis by proteolytic enzymes. Several physiological effects have been attributed to these peptides, such as blood pressure reduction, scavenging of oxidative compounds, induction of satiety and reduction of cholesterol. Due to their ab...

A bioactive peptide amidating enzyme is required for ciliogenesis

The pathways controlling cilium biogenesis in different cell types have not been fully elucidated. We recently identified peptidylglycine α-amidating monooxygenase (PAM), an enzyme required for generating amidated bioactive signaling peptides, in Chlamydomonas and mammalian cilia. Here, we show that PAM is required for the normal assembly of motile and primary cilia in Chlamydomonas, planaria a...

A novel bioactive peptide from wasp venom

Wasp venoms contain a number of pharmacologically active biomolecules, undertaking a wide range of functions necessary for the wasp's survival. We purified and characterized a novel bioactive peptide (vespin) from the venoms of Vespa magnifica (Smith) wasps with unique primary structure. Its amino acid sequence was determined to be CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY. It has 44 residue...

[C-peptide].

Peptide and Protein Delivery at a Glance

Peptide and protein drugs have found an important position in therapeutics. Recent advances in pharmaceutical biotechnology have led to an increase in the number of protein products in the market. As these therapeutic proteins and peptides are made available, it will be essential to formulate these drugs into safe and effective delivery systems. The twenty different naturally occurring amin...